| Class b: All beta proteins [48724] (180 folds) |
| Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) ![]() automatically mapped to Pfam PF01847 |
| Family b.3.3.1: VHL [49469] (2 proteins) |
| Protein VHL [49470] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
| Domain d4w9el_: 4w9e L: [259569] Other proteins in same PDB: d4w9ea_, d4w9eb_, d4w9ed_, d4w9ee_, d4w9eg_, d4w9eh_, d4w9ej_, d4w9ek1, d4w9ek2 automated match to d1lqbc_ complexed with 3jt |
PDB Entry: 4w9e (more details), 2.6 Å
SCOPe Domain Sequences for d4w9el_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w9el_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltqe
Timeline for d4w9el_: