Lineage for d4w9jd_ (4w9j D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1892546Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1892571Protein Elongin B [54246] (2 species)
  7. 1892572Species Human (Homo sapiens) [TaxId:9606] [54247] (27 PDB entries)
  8. 1892614Domain d4w9jd_: 4w9j D: [259559]
    Other proteins in same PDB: d4w9jb_, d4w9jc_, d4w9je_, d4w9jf_, d4w9jh_, d4w9ji_, d4w9jk_, d4w9jl_
    automated match to d4b9ka_
    complexed with 3jh

Details for d4w9jd_

PDB Entry: 4w9j (more details), 2.2 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-((S)-2-((S)-2-acetamido-4-methylpentanamido)-3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 13)
PDB Compounds: (D:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4w9jd_:

Sequence, based on SEQRES records: (download)

>d4w9jd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

Sequence, based on observed residues (ATOM records): (download)

>d4w9jd_ d.15.1.1 (D:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafradtfealciepfssppelpdvm

SCOPe Domain Coordinates for d4w9jd_:

Click to download the PDB-style file with coordinates for d4w9jd_.
(The format of our PDB-style files is described here.)

Timeline for d4w9jd_: