Lineage for d4uqta_ (4uqt A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2952471Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2952472Protein automated matches [190896] (11 species)
    not a true protein
  7. 2952473Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189319] (9 PDB entries)
  8. 2952485Domain d4uqta_: 4uqt A: [259556]
    automated match to d2rraa_

Details for d4uqta_

PDB Entry: 4uqt (more details)

PDB Description: RRM-peptide structure in RES complex
PDB Compounds: (A:) U2 snRNP component IST3

SCOPe Domain Sequences for d4uqta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uqta_ d.58.7.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
neykdnayiyignlnreltegdiltvfseygvpvdvilsrdentgesqgfaylkyedqrs
tilavdnlngfkiggralkidhtfyrpkr

SCOPe Domain Coordinates for d4uqta_:

Click to download the PDB-style file with coordinates for d4uqta_.
(The format of our PDB-style files is described here.)

Timeline for d4uqta_: