Lineage for d4untd_ (4unt D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024002Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)
  8. 2024317Domain d4untd_: 4unt D: [259553]
    automated match to d2rhea_
    complexed with so4

Details for d4untd_

PDB Entry: 4unt (more details), 2.7 Å

PDB Description: Induced monomer of the Mcg variable domain
PDB Compounds: (D:) ig lambda chain v-II region mgc

SCOPe Domain Sequences for d4untd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4untd_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
saltqppsasgslgqsvtisctgtssdvggynyvsweqqhagkapkviiyevnkrpsgvp
drfsgsksgntasltvsglqaedeadyycssyegsdnavegtgtkvtvl

SCOPe Domain Coordinates for d4untd_:

Click to download the PDB-style file with coordinates for d4untd_.
(The format of our PDB-style files is described here.)

Timeline for d4untd_: