| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.10: Stathmin [101494] (1 family) ![]() single long helix crosslinking four tubulin subunits automatically mapped to Pfam PF00836 |
| Family a.137.10.1: Stathmin [101495] (1 protein) |
| Protein Stathmin 4 [101496] (1 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (25 PDB entries) |
| Domain d4tv9e_: 4tv9 E: [259543] Other proteins in same PDB: d4tv9a1, d4tv9a2, d4tv9d1, d4tv9d2 automated match to d3ryce_ complexed with 3h4, acp, ca, gdp, gol, gtp, mes, mg |
PDB Entry: 4tv9 (more details), 2 Å
SCOPe Domain Sequences for d4tv9e_:
Sequence, based on SEQRES records: (download)
>d4tv9e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkee
>d4tv9e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
ee
Timeline for d4tv9e_:
View in 3DDomains from other chains: (mouse over for more information) d4tv9a1, d4tv9a2, d4tv9d1, d4tv9d2 |