Lineage for d4tvsb_ (4tvs b:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758808Species Vicugna pacos [TaxId:30538] [189756] (9 PDB entries)
  8. 1758813Domain d4tvsb_: 4tvs b: [259542]
    automated match to d4heme_
    complexed with gol, so4

Details for d4tvsb_

PDB Entry: 4tvs (more details), 1.6 Å

PDB Description: LAP1(aa356-583), H.sapiens, bound to VHH-BS1
PDB Compounds: (b:) VHH Domain BS-1

SCOPe Domain Sequences for d4tvsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tvsb_ b.1.1.1 (b:) automated matches {Vicugna pacos [TaxId: 30538]}
mqvqlvesggglvqaggslrlscaasgrtlssyavgwfrqapglerefvatisrsggsth
yadsvkgrftisrdnakntvylqmnslkpedtavyycaatftpdgswyytrgssydywgq
gtqvtvss

SCOPe Domain Coordinates for d4tvsb_:

Click to download the PDB-style file with coordinates for d4tvsb_.
(The format of our PDB-style files is described here.)

Timeline for d4tvsb_: