Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (18 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (9 PDB entries) |
Domain d4tvsb_: 4tvs b: [259542] automated match to d4heme_ complexed with gol, so4 |
PDB Entry: 4tvs (more details), 1.6 Å
SCOPe Domain Sequences for d4tvsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4tvsb_ b.1.1.1 (b:) automated matches {Vicugna pacos [TaxId: 30538]} mqvqlvesggglvqaggslrlscaasgrtlssyavgwfrqapglerefvatisrsggsth yadsvkgrftisrdnakntvylqmnslkpedtavyycaatftpdgswyytrgssydywgq gtqvtvss
Timeline for d4tvsb_: