SCOPe 2.05: Domain d4tu1b_: 4tu1 B:

Lineage for d4tu1b_ (4tu1 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.1: Class I aldolase [51570] (13 proteins)
   the catalytic lysine forms schiff-base intermediate with substrate
   possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels

6. Protein automated matches [190095] (20 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:5811] [259539] (2 PDB entries)

8. Domain d4tu1b_: 4tu1 B: [259541]
   automated match to d1xfba1
   complexed with gol

Details for d4tu1b_

PDB Entry: 4tu1, 2 Å

PDB Description: structure of toxoplasma gondii fructose 1,6 bisphosphate aldolase

PDB Compounds: (B:) fructose-1,6-bisphosphate aldolase

SCOPe Domain Sequences for d4tu1b_:

Sequence; same for both SEQRES and ATOM records:

>d4tu1b_ c.1.10.1 (B:) automated matches {Toxoplasma gondii [TaxId: 5811]}
tqgpgsmisqevakelaenarkiaapgkgilaadestgtikkrfdsigventeanrafyr
dllfstkglgqyisgailfeetlyqkspsgvpmvdllkaegiipgikvdkgletlpltdd
ekatmgldglserckkyyeagarfakwravlsidpakgkptnlsitevahglaryaaicq
anrlvpivepeiltdgshditvcaevtervlaavfkalndhhvllegallkpnmvthgsd
cpkpasheeiafytvrslkrtvppalpgvmflsggqseedaslnlnemnkmgphpfqlsf
sygralqasclkawkgvpenkakaqqvlmerarangeaql

Timeline for d4tu1b_:

• d4tu1b_ first appeared in SCOPe 2.04
  
• d4tu1b_ is called d4tu1b1 in SCOPe 2.06
  
• d4tu1b_ appears in the current release, SCOPe 2.08, called d4tu1b1