Lineage for d4tr8b2 (4tr8 B:122-245)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1669824Fold d.131: DNA clamp [55978] (1 superfamily)
    contains two helices and two beta sheets
    duplication: fold has internal pseudo two-fold symmetry
  4. 1669825Superfamily d.131.1: DNA clamp [55979] (3 families) (S)
  5. 1670188Family d.131.1.0: automated matches [227185] (1 protein)
    not a true family
  6. 1670189Protein automated matches [226907] (12 species)
    not a true protein
  7. 1670228Species Pseudomonas aeruginosa [TaxId:983919] [259535] (1 PDB entry)
  8. 1670230Domain d4tr8b2: 4tr8 B:122-245 [259537]
    automated match to d1vpka2
    complexed with na

Details for d4tr8b2

PDB Entry: 4tr8 (more details), 1.8 Å

PDB Description: Crystal structure of DNA polymerase sliding clamp from Pseudomonas aeruginosa
PDB Compounds: (B:) DNA polymerase III subunit beta

SCOPe Domain Sequences for d4tr8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tr8b2 d.131.1.0 (B:122-245) automated matches {Pseudomonas aeruginosa [TaxId: 983919]}
gpgslnfsiaqsklrrlidrtsfamaqqdvryylngmllevnggtlrsvatdghrlamcs
ldaqipsqdrhqvivprkgilelarllteqdgevgivlgqhhirattgeftftsklvdgk
fpdy

SCOPe Domain Coordinates for d4tr8b2:

Click to download the PDB-style file with coordinates for d4tr8b2.
(The format of our PDB-style files is described here.)

Timeline for d4tr8b2: