Lineage for d1ezxc_ (1ezx C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405549Protein Trypsin(ogen) [50515] (9 species)
  7. 2405567Species Cow (Bos taurus) [TaxId:9913] [50516] (494 PDB entries)
    Uniprot P00760
  8. 2406063Domain d1ezxc_: 1ezx C: [25953]
    Other proteins in same PDB: d1ezx.1
    complexed with serpin

Details for d1ezxc_

PDB Entry: 1ezx (more details), 2.6 Å

PDB Description: crystal structure of a serpin:protease complex
PDB Compounds: (C:) Trypsin

SCOPe Domain Sequences for d1ezxc_:

Sequence, based on SEQRES records: (download)

>d1ezxc_ b.47.1.2 (C:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cggslinsqwvvsaahcyksgiqvrlgedninvvegneqfisasksivhpsynsntlnnd
imliklksaaslnsrvasislptscasagtqclisgwgntkssgtsypdvlkclkapils
dsscksaypgqitsnmfcagyleggkdscqgdsggpvvcsgklqgivswgsgcaqknkpg
vytkvcnyvswikqtiasn

Sequence, based on observed residues (ATOM records): (download)

>d1ezxc_ b.47.1.2 (C:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cggslinsqwvvsaahcyksasksivhpsynsntlnndimliklkislptscasagtqcl
iclkapilsdsscksaypgqitsnmfcagylcqgdsggpvvcsgklqgivswgsgcaqkp
gvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d1ezxc_:

Click to download the PDB-style file with coordinates for d1ezxc_.
(The format of our PDB-style files is described here.)

Timeline for d1ezxc_: