Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
Domain d4r4bc2: 4r4b C:107-211 [259529] Other proteins in same PDB: d4r4ba1, d4r4bc1, d4r4bl1 automated match to d2fjha2 complexed with nag, so4 |
PDB Entry: 4r4b (more details), 2.2 Å
SCOPe Domain Sequences for d4r4bc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r4bc2 b.1.1.2 (C:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d4r4bc2:
View in 3D Domains from other chains: (mouse over for more information) d4r4ba1, d4r4ba2, d4r4bl1, d4r4bl2 |