Lineage for d4r4bc2 (4r4b C:107-211)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517480Domain d4r4bc2: 4r4b C:107-211 [259529]
    Other proteins in same PDB: d4r4ba1, d4r4bc1, d4r4bl1
    automated match to d2fjha2
    complexed with nag, so4

Details for d4r4bc2

PDB Entry: 4r4b (more details), 2.2 Å

PDB Description: crystal structure of the anti-hiv-1 antibody 2.2c
PDB Compounds: (C:) fab 2.2c light chain

SCOPe Domain Sequences for d4r4bc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r4bc2 b.1.1.2 (C:107-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d4r4bc2:

Click to download the PDB-style file with coordinates for d4r4bc2.
(The format of our PDB-style files is described here.)

Timeline for d4r4bc2: