SCOPe 2.04: Domain d4r5ka2: 4r5k A:508-605

Lineage for d4r5ka2 (4r5k A:508-605)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families)

5. Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)

6. Protein automated matches [227118] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [259518] (3 PDB entries)

8. Domain d4r5ka2: 4r5k A:508-605 [259521]
   Other proteins in same PDB: d4r5ka1, d4r5kb1
   automated match to d1dkxa1
   complexed with ca, so4

Details for d4r5ka2

PDB Entry: 4r5k, 1.75 Å

PDB Description: Crystal structure of the DnaK C-terminus (Dnak-SBD-B)

PDB Compounds: (A:) Chaperone protein dnaK

SCOPe Domain Sequences for d4r5ka2:

Sequence; same for both SEQRES and ATOM records:

>d4r5ka2 a.8.4.1 (A:508-605) automated matches {Escherichia coli [TaxId: 83333]}
nedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaies
altaletalkgedkaaieakmqelaqvsqklmeiaqqq

Timeline for d4r5ka2:

• d4r5ka2 is new in SCOPe 2.04-stable
  
• d4r5ka2 appears in SCOPe 2.05
  
• d4r5ka2 appears in the current release, SCOPe 2.08