SCOPe 2.04: Domain d4r5lb1: 4r5l B:378-506

Lineage for d4r5lb1 (4r5l B:378-506)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
   beta-sandwich: 8 strands in 2 sheets

4. Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family)

5. Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)

6. Protein automated matches [227117] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [259516] (3 PDB entries)

8. Domain d4r5lb1: 4r5l B:378-506 [259517]
   Other proteins in same PDB: d4r5lb2
   automated match to d1dkxa2
   complexed with ca, po4, so4

Details for d4r5lb1

PDB Entry: 4r5l, 2.97 Å

PDB Description: Crystal structure of the DnaK C-terminus (Dnak-SBD-C)

PDB Compounds: (B:) Chaperone protein dnaK

SCOPe Domain Sequences for d4r5lb1:

Sequence; same for both SEQRES and ATOM records:

>d4r5lb1 b.130.1.1 (B:378-506) automated matches {Escherichia coli [TaxId: 83333]}
mhhhhhhiegrvllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavt
ihvlqgerkraadnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeq
kitikassg

Timeline for d4r5lb1:

• d4r5lb1 is new in SCOPe 2.04-stable
  
• d4r5lb1 appears in SCOPe 2.05
  
• d4r5lb1 appears in the current release, SCOPe 2.08