Lineage for d4r40c1 (4r40 C:23-161)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2135875Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2136027Superfamily c.51.2: TolB, N-terminal domain [52964] (2 families) (S)
  5. 2136041Family c.51.2.0: automated matches [232575] (1 protein)
    not a true family
  6. 2136042Protein automated matches [232576] (2 species)
    not a true protein
  7. 2136049Species Yersinia pestis [TaxId:214092] [256379] (2 PDB entries)
  8. 2136053Domain d4r40c1: 4r40 C:23-161 [259514]
    Other proteins in same PDB: d4r40a2, d4r40b_, d4r40c2, d4r40d_
    automated match to d4pwza1
    complexed with fmt, gol, so4

Details for d4r40c1

PDB Entry: 4r40 (more details), 2.5 Å

PDB Description: Crystal Structure of TolB/Pal complex from Yersinia pestis.
PDB Compounds: (C:) protein tolb

SCOPe Domain Sequences for d4r40c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r40c1 c.51.2.0 (C:23-161) automated matches {Yersinia pestis [TaxId: 214092]}
vrieitqgvdsarpigvvpfkwmgpgtppeeigaivgadlrnsgkfnpidaarmpqqpst
aaevtpaawtalgidavvvgqvqpsadgsyvvsyqlvdtsgsagsilaqnqykvtkqwlr
ysahtvsdevfekltgikg

SCOPe Domain Coordinates for d4r40c1:

Click to download the PDB-style file with coordinates for d4r40c1.
(The format of our PDB-style files is described here.)

Timeline for d4r40c1: