![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.7: OmpA-like [103088] (2 families) ![]() |
![]() | Family d.79.7.1: OmpA-like [103089] (3 proteins) Pfam PF00691 |
![]() | Protein automated matches [190318] (2 species) not a true protein |
![]() | Species Yersinia pestis [TaxId:214092] [238503] (2 PDB entries) |
![]() | Domain d4r40d_: 4r40 D: [259513] Other proteins in same PDB: d4r40a1, d4r40a2, d4r40c1, d4r40c2 automated match to d4pwta_ complexed with fmt, gol, so4 |
PDB Entry: 4r40 (more details), 2.5 Å
SCOPe Domain Sequences for d4r40d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r40d_ d.79.7.1 (D:) automated matches {Yersinia pestis [TaxId: 214092]} snlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdkvvvegha dergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaafaknrra vlvy
Timeline for d4r40d_: