SCOPe 2.06: Domain d4r40d_: 4r40 D:

Lineage for d4r40d_ (4r40 D:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.7: OmpA-like [103088] (2 families)

5. Family d.79.7.1: OmpA-like [103089] (3 proteins)
   Pfam PF00691

6. Protein automated matches [190318] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [238503] (2 PDB entries)

8. Domain d4r40d_: 4r40 D: [259513]
   Other proteins in same PDB: d4r40a1, d4r40a2, d4r40c1, d4r40c2
   automated match to d4pwta_
   complexed with fmt, gol, so4

Details for d4r40d_

PDB Entry: 4r40, 2.5 Å

PDB Description: Crystal Structure of TolB/Pal complex from Yersinia pestis.

PDB Compounds: (D:) peptidoglycan-associated lipoprotein

SCOPe Domain Sequences for d4r40d_:

Sequence; same for both SEQRES and ATOM records:

>d4r40d_ d.79.7.1 (D:) automated matches {Yersinia pestis [TaxId: 214092]}
snlsseeqarlqmqelqknnivyfgfdkydigsdfaqmldahaaflrsnpsdkvvvegha
dergtpeynialgerrasavkmylqgkgvsadqisivsygkekpavlghdeaafaknrra
vlvy

Timeline for d4r40d_:

• d4r40d_ first appeared in SCOPe 2.04
  
• d4r40d_ appears in SCOPe 2.05
  
• d4r40d_ appears in SCOPe 2.07
  
• d4r40d_ appears in the current release, SCOPe 2.08