Lineage for d4qxaa_ (4qxa A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124894Protein Rab9a [110537] (3 species)
  7. 2124901Species Mouse (Mus musculus) [TaxId:10090] [142229] (2 PDB entries)
    Uniprot Q9R0M6 4-175
  8. 2124903Domain d4qxaa_: 4qxa A: [259511]
    automated match to d1yhna_
    complexed with gtp, mg

Details for d4qxaa_

PDB Entry: 4qxa (more details), 2.3 Å

PDB Description: crystal structure of the rab9a-rutbc2 rbd complex
PDB Compounds: (A:) Ras-related protein Rab-9A

SCOPe Domain Sequences for d4qxaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qxaa_ c.37.1.8 (A:) Rab9a {Mouse (Mus musculus) [TaxId: 10090]}
slfkiillgdggvgksslmnryvtnkfdsqlfhtigveflnkdlevdghfvtmqiwdtag
lerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvilgnk
tdikerqvsteeaqawckdngdypyfetsakdstnvaaafeeavrrilated

SCOPe Domain Coordinates for d4qxaa_:

Click to download the PDB-style file with coordinates for d4qxaa_.
(The format of our PDB-style files is described here.)

Timeline for d4qxaa_: