Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab9a [110537] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [142229] (2 PDB entries) Uniprot Q9R0M6 4-175 |
Domain d4qxaa_: 4qxa A: [259511] automated match to d1yhna_ complexed with gtp, mg |
PDB Entry: 4qxa (more details), 2.3 Å
SCOPe Domain Sequences for d4qxaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qxaa_ c.37.1.8 (A:) Rab9a {Mouse (Mus musculus) [TaxId: 10090]} slfkiillgdggvgksslmnryvtnkfdsqlfhtigveflnkdlevdghfvtmqiwdtag lerfrslrtpfyrgsdcclltfsvddsqsfqnlsnwkkefiyyadvkepesfpfvilgnk tdikerqvsteeaqawckdngdypyfetsakdstnvaaafeeavrrilated
Timeline for d4qxaa_: