Lineage for d1g9ie_ (1g9i E:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries) 
Domain d1g9ie_: 1g9i E: [25951]
Details for d1g9ie_
PDB Entry: 1g9i (more details), 2.2 Å
PDB Description: crystal structure of beta-trysin complex in cyclohexane
SCOP Domain Sequences for d1g9ie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9ie_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
SCOP Domain Coordinates for d1g9ie_:
Click to download the PDB-style file with coordinates for d1g9ie_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1g9ie_:
- d1g9ie_ appears in SCOP 1.57
- d1g9ie_ appears in the current release, SCOPe 2.08
View in 3D