![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
![]() | Protein automated matches [190220] (14 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:122586] [259505] (1 PDB entry) |
![]() | Domain d4quoa4: 4quo A:540-867 [259506] Other proteins in same PDB: d4quoa1, d4quoa2, d4quoa3 automated match to d2gtqa4 complexed with 3dz, gol, imd, so4, zn |
PDB Entry: 4quo (more details), 1.65 Å
SCOPe Domain Sequences for d4quoa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4quoa4 a.118.1.0 (A:540-867) automated matches {Neisseria meningitidis [TaxId: 122586]} pysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvis ddlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaa kqenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavn gnesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnk arsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrkn lvkqalqriraqeglskdvgeivgkild
Timeline for d4quoa4: