Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (4 species) not a true protein |
Species Neisseria meningitidis [TaxId:122586] [259503] (1 PDB entry) |
Domain d4quoa3: 4quo A:439-539 [259504] Other proteins in same PDB: d4quoa1, d4quoa2, d4quoa4 automated match to d2gtqa3 complexed with 3dz, gol, imd, so4, zn |
PDB Entry: 4quo (more details), 1.65 Å
SCOPe Domain Sequences for d4quoa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4quoa3 b.1.30.0 (A:439-539) automated matches {Neisseria meningitidis [TaxId: 122586]} agtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgllnrngeavafdyqgk rateavlllteaeqtfllegvteavvpsllrgfsapvhlny
Timeline for d4quoa3: