Lineage for d4quoa3 (4quo A:439-539)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766995Family b.1.30.0: automated matches [254306] (1 protein)
    not a true family
  6. 2766996Protein automated matches [254707] (4 species)
    not a true protein
  7. 2767038Species Neisseria meningitidis [TaxId:122586] [259503] (1 PDB entry)
  8. 2767039Domain d4quoa3: 4quo A:439-539 [259504]
    Other proteins in same PDB: d4quoa1, d4quoa2, d4quoa4
    automated match to d2gtqa3
    complexed with 3dz, gol, imd, so4, zn

Details for d4quoa3

PDB Entry: 4quo (more details), 1.65 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphinic dipeptide analogue ll-(r,s)-hphep[ch2]phe(3-ch2nh2)
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4quoa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4quoa3 b.1.30.0 (A:439-539) automated matches {Neisseria meningitidis [TaxId: 122586]}
agtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkvgllnrngeavafdyqgk
rateavlllteaeqtfllegvteavvpsllrgfsapvhlny

SCOPe Domain Coordinates for d4quoa3:

Click to download the PDB-style file with coordinates for d4quoa3.
(The format of our PDB-style files is described here.)

Timeline for d4quoa3: