SCOPe 2.07: Domain d4quoa2: 4quo A:189-438

Lineage for d4quoa2 (4quo A:189-438)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (18 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:122586] [259500] (1 PDB entry)

8. Domain d4quoa2: 4quo A:189-438 [259501]
   Other proteins in same PDB: d4quoa1, d4quoa3, d4quoa4
   automated match to d2gtqa2
   complexed with 3dz, gol, imd, so4, zn

Details for d4quoa2

PDB Entry: 4quo, 1.65 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphinic dipeptide analogue ll-(r,s)-hphep[ch2]phe(3-ch2nh2)

PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4quoa2:

Sequence; same for both SEQRES and ATOM records:

>d4quoa2 d.92.1.0 (A:189-438) automated matches {Neisseria meningitidis [TaxId: 122586]}
dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv
vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd
wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem
nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin
ldqfalwysq

Timeline for d4quoa2:

• d4quoa2 first appeared in SCOPe 2.04
  
• d4quoa2 appears in SCOPe 2.06
  
• d4quoa2 appears in the current release, SCOPe 2.08