![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
![]() | Protein automated matches [190805] (20 species) not a true protein |
![]() | Species Neisseria meningitidis [TaxId:122586] [259500] (1 PDB entry) |
![]() | Domain d4quoa2: 4quo A:189-438 [259501] Other proteins in same PDB: d4quoa1, d4quoa3, d4quoa4 automated match to d2gtqa2 complexed with 3dz, gol, imd, so4, zn |
PDB Entry: 4quo (more details), 1.65 Å
SCOPe Domain Sequences for d4quoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4quoa2 d.92.1.0 (A:189-438) automated matches {Neisseria meningitidis [TaxId: 122586]} dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin ldqfalwysq
Timeline for d4quoa2: