Lineage for d4quoa2 (4quo A:189-438)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964873Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2964874Protein automated matches [190805] (20 species)
    not a true protein
  7. 2965053Species Neisseria meningitidis [TaxId:122586] [259500] (1 PDB entry)
  8. 2965054Domain d4quoa2: 4quo A:189-438 [259501]
    Other proteins in same PDB: d4quoa1, d4quoa3, d4quoa4
    automated match to d2gtqa2
    complexed with 3dz, gol, imd, so4, zn

Details for d4quoa2

PDB Entry: 4quo (more details), 1.65 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphinic dipeptide analogue ll-(r,s)-hphep[ch2]phe(3-ch2nh2)
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4quoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4quoa2 d.92.1.0 (A:189-438) automated matches {Neisseria meningitidis [TaxId: 122586]}
dlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgleydldifmv
vavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtgnrvtcrd
wfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvrpasyeem
nnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraamadangin
ldqfalwysq

SCOPe Domain Coordinates for d4quoa2:

Click to download the PDB-style file with coordinates for d4quoa2.
(The format of our PDB-style files is described here.)

Timeline for d4quoa2: