SCOPe 2.03: Domain d3btwe_: 3btw E:

Lineage for d3btwe_ (3btw E:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
   Uniprot P00760

8. Domain d3btwe_: 3btw E: [25950]
   Other proteins in same PDB: d3btwi_
   complexed with ca, so4

Details for d3btwe_

PDB Entry: 3btw, 2.05 Å

PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti

PDB Compounds: (E:) protein (trypsin)

SCOPe Domain Sequences for d3btwe_:

Sequence, based on SEQRES records:

>d3btwe_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Sequence, based on observed residues (ATOM records):

>d3btwe_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslsrvasislptscasagtqclisgw
gntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggpv
vcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d3btwe_:

• d3btwe_ first appeared (with stable ids) in SCOP 1.55
  
• d3btwe_ appears in SCOPe 2.02
  
• d3btwe_ appears in SCOPe 2.04
  
• d3btwe_ appears in the current release, SCOPe 2.08