Lineage for d4quoa1 (4quo A:3-188)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820567Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
    duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain
  4. 2820568Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) (S)
  5. 2820655Family b.98.1.0: automated matches [254305] (1 protein)
    not a true family
  6. 2820656Protein automated matches [254706] (5 species)
    not a true protein
  7. 2820708Species Neisseria meningitidis [TaxId:122586] [259498] (1 PDB entry)
  8. 2820709Domain d4quoa1: 4quo A:3-188 [259499]
    Other proteins in same PDB: d4quoa2, d4quoa3, d4quoa4
    automated match to d2gtqa1
    complexed with 3dz, gol, imd, so4, zn

Details for d4quoa1

PDB Entry: 4quo (more details), 1.65 Å

PDB Description: crystal structure of aminopeptidase n in complex with the phosphinic dipeptide analogue ll-(r,s)-hphep[ch2]phe(3-ch2nh2)
PDB Compounds: (A:) Aminopeptidase N

SCOPe Domain Sequences for d4quoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4quoa1 b.98.1.0 (A:3-188) automated matches {Neisseria meningitidis [TaxId: 122586]}
ktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvki
ngaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegfr
kitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsyl
falvag

SCOPe Domain Coordinates for d4quoa1:

Click to download the PDB-style file with coordinates for d4quoa1.
(The format of our PDB-style files is described here.)

Timeline for d4quoa1: