| Class b: All beta proteins [48724] (180 folds) |
| Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) ![]() |
| Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
| Protein automated matches [254706] (5 species) not a true protein |
| Species Neisseria meningitidis [TaxId:122586] [259498] (1 PDB entry) |
| Domain d4quoa1: 4quo A:3-188 [259499] Other proteins in same PDB: d4quoa2, d4quoa3, d4quoa4 automated match to d2gtqa1 complexed with 3dz, gol, imd, so4, zn |
PDB Entry: 4quo (more details), 1.65 Å
SCOPe Domain Sequences for d4quoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4quoa1 b.98.1.0 (A:3-188) automated matches {Neisseria meningitidis [TaxId: 122586]}
ktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvki
ngaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegfr
kitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsyl
falvag
Timeline for d4quoa1: