SCOPe 2.05: Domain d4qpoa_: 4qpo A:

Lineage for d4qpoa_ (4qpo A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.2: DNA-binding domain (fragment?) of the TraM protein [63566] (2 proteins)
   old provisional classification awaiting the entire protein structure; structure of a different fragment of this protein (PDB 2g7o) is classified into a different superfamily
   automatically mapped to Pfam PF05261

6. Protein automated matches [259492] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [259493] (1 PDB entry)

8. Domain d4qpoa_: 4qpo A: [259495]
   automated match to d1dp3a_
   complexed with po4

Details for d4qpoa_

PDB Entry: 4qpo, 2 Å

PDB Description: Mechanistic basis of plasmid-specific DNA binding of the F plasmid regulatory protein, TraM

PDB Compounds: (A:) Relaxosome protein TraM

SCOPe Domain Sequences for d4qpoa_:

Sequence; same for both SEQRES and ATOM records:

>d4qpoa_ a.55.1.2 (A:) automated matches {Escherichia coli [TaxId: 83333]}
akvnlyisndayekinaiiekrrqegarekdvsfsatasmllelglrvheaqm

Timeline for d4qpoa_:

• d4qpoa_ first appeared in SCOPe 2.04
  
• d4qpoa_ appears in SCOPe 2.06
  
• d4qpoa_ appears in the current release, SCOPe 2.08