Lineage for d4qe5a_ (4qe5 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839095Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 2839096Protein D-xylose isomerase [51666] (13 species)
  7. 2839224Species Streptomyces rubiginosus [TaxId:1929] [51670] (89 PDB entries)
  8. 2839261Domain d4qe5a_: 4qe5 A: [259489]
    automated match to d1mnza_
    complexed with mg, ruu

Details for d4qe5a_

PDB Entry: 4qe5 (more details), 1.56 Å

PDB Description: room temperature x-ray structure of d-xylose isomerase in complex with two mg2+ ions and l-ribulose
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d4qe5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qe5a_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlip
fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
dvdaaaargmaferldqlamdhllgarg

SCOPe Domain Coordinates for d4qe5a_:

Click to download the PDB-style file with coordinates for d4qe5a_.
(The format of our PDB-style files is described here.)

Timeline for d4qe5a_: