Lineage for d4qeea_ (4qee A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1575074Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 1575125Family c.1.15.3: Xylose isomerase [51665] (2 proteins)
  6. 1575126Protein D-xylose isomerase [51666] (13 species)
  7. 1575254Species Streptomyces rubiginosus [TaxId:1929] [51670] (40 PDB entries)
  8. 1575281Domain d4qeea_: 4qee A: [259486]
    automated match to d1mnza_
    complexed with ni, z6j

Details for d4qeea_

PDB Entry: 4qee (more details), 1.6 Å

PDB Description: room temperature x-ray structure of d-xylose isomerase in complex with two ni2+ ions and l-ribose
PDB Compounds: (A:) xylose isomerase

SCOPe Domain Sequences for d4qeea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qeea_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces rubiginosus [TaxId: 1929]}
mnyqptpedrftfglwtvgwqgrdpfgdatrraldpvesvrrlaelgahgvtfhdddlip
fgssdsereehvkrfrqalddtgmkvpmattnlfthpvfkdggftandrdvrryalrkti
rnidlavelgaetyvawggregaesggakdvrdaldrmkeafdllgeyvtsqgydirfai
epkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagk
lfhidlngqngikydqdlrfgagdlraafwlvdllesagysgprhfdfkpprtedfdgvw
asaagcmrnylilkeraaafradpevqealrasrldelarptaadglqallddrsafeef
dvdaaaargmaferldqlamdhllgarg

SCOPe Domain Coordinates for d4qeea_:

Click to download the PDB-style file with coordinates for d4qeea_.
(The format of our PDB-style files is described here.)

Timeline for d4qeea_: