Lineage for d4q74b1 (4q74 B:237-339)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516071Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 1516072Species Human (Homo sapiens) [TaxId:9606] [88585] (35 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 1516094Domain d4q74b1: 4q74 B:237-339 [259483]
    Other proteins in same PDB: d4q74b2
    automated match to d1hzhh3
    complexed with bma, fuc

Details for d4q74b1

PDB Entry: 4q74 (more details), 2.19 Å

PDB Description: f241a fc
PDB Compounds: (B:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4q74b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q74b1 b.1.1.2 (B:237-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
gpsvalfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d4q74b1:

Click to download the PDB-style file with coordinates for d4q74b1.
(The format of our PDB-style files is described here.)

Timeline for d4q74b1: