Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187421] (74 PDB entries) |
Domain d4q7za_: 4q7z A: [259480] automated match to d1trna_ complexed with 2yt, cl, gol, nag |
PDB Entry: 4q7z (more details), 1.4 Å
SCOPe Domain Sequences for d4q7za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q7za_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} iigghevtphsrpymasvrfggqhhcggfllrarwvvsaahcfshrdlrtglvvlgahvl staeptqqvfgidaltthpdyhpmthandicllrlngsavlgpavgllrlpgrrarppta gtrcrvagwgfvsdfeelppglmeakvrvldpdvcnsswkghltltmlctrsgdshrrgf csadsggplvcrnrahglvsfsglwcgdpktpdvytqvsafvawiwdvvrrss
Timeline for d4q7za_: