Lineage for d1auj__ (1auj -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60859Protein Trypsin(ogen) [50515] (6 species)
  7. 60860Species Cow (Bos taurus) [TaxId:9913] [50516] (128 PDB entries)
  8. 60973Domain d1auj__: 1auj - [25948]

Details for d1auj__

PDB Entry: 1auj (more details), 2.1 Å

PDB Description: bovine trypsin complexed to meta-cyano-benzylic inhibitor

SCOP Domain Sequences for d1auj__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auj__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1auj__:

Click to download the PDB-style file with coordinates for d1auj__.
(The format of our PDB-style files is described here.)

Timeline for d1auj__: