Lineage for d4q76b_ (4q76 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2131439Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2131631Protein automated matches [190399] (9 species)
    not a true protein
  7. 2131683Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [259476] (2 PDB entries)
  8. 2131687Domain d4q76b_: 4q76 B: [259479]
    automated match to d1t3ia_
    mutant

Details for d4q76b_

PDB Entry: 4q76 (more details), 1.9 Å

PDB Description: crystal structure of nfs2 c384s mutant, the plastidial cysteine desulfurase from arabidopsis thaliana
PDB Compounds: (B:) Cysteine desulfurase 2, chloroplastic

SCOPe Domain Sequences for d4q76b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q76b_ c.67.1.3 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
vslghrvrkdfrilhqevngsklvyldsaatsqkpaavldalqnyyefynsnvhrgihyl
sakatdefelarkkvarfinasdsreivftrnateainlvayswglsnlkpgdeviltva
ehhscivpwqivsqktgavlkfvtlnedevpdinklrelispktklvavhhvsnvlassl
pieeivvwahdvgakvlvdacqsvphmvvdvqklnadflvasshkmcgptgigflygksd
llhsmppflgggemisdvfldhstyaeppsrfeagtpaigeaialgaavdylsgigmpki
heyeveigkylyeklsslpdvriygprpsesvhrgalcsfnveglhptdlatfldqqhgv
airsghhsaqplhrylgvnasaraslyfyntkddvdafivaladtvsffnsfk

SCOPe Domain Coordinates for d4q76b_:

Click to download the PDB-style file with coordinates for d4q76b_.
(The format of our PDB-style files is described here.)

Timeline for d4q76b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4q76a_