SCOPe 2.06: Domain d4q2pa1: 4q2p A:132-226

Lineage for d4q2pa1 (4q2p A:132-226)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)

8. Domain d4q2pa1: 4q2p A:132-226 [259474]
   Other proteins in same PDB: d4q2pa2
   automated match to d2edza_
   complexed with edo, trs

Details for d4q2pa1

PDB Entry: 4q2p, 2.05 Å

PDB Description: NHERF3 PDZ2 in Complex with a Phage-Derived Peptide

PDB Compounds: (A:) Na(+)/H(+) exchange regulatory cofactor NHE-RF3

SCOPe Domain Sequences for d4q2pa1:

Sequence; same for both SEQRES and ATOM records:

>d4q2pa1 b.36.1.0 (A:132-226) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qprlcylvkeggsygfslktvqgkkgvymtditpqgvamragvladdhlievngenveda
sheevvekvkksgsrvmfllvdkeaagggikitkf

Timeline for d4q2pa1:

• d4q2pa1 first appeared in SCOPe 2.04, called d4q2pa_
  
• d4q2pa1 was called d4q2pa_ in SCOPe 2.05
  
• d4q2pa1 appears in SCOPe 2.07
  
• d4q2pa1 appears in the current release, SCOPe 2.08