Lineage for d4q2qa_ (4q2q A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2048292Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2048293Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2048811Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2048812Protein automated matches [190436] (8 species)
    not a true protein
  7. 2048826Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)
  8. 2048867Domain d4q2qa_: 4q2q A: [259470]
    automated match to d3cbxa_

Details for d4q2qa_

PDB Entry: 4q2q (more details), 1.45 Å

PDB Description: ZO1 PDZ3 in Complex with a Phage-Derived Peptide
PDB Compounds: (A:) Tight junction protein ZO-1

SCOPe Domain Sequences for d4q2qa_:

Sequence, based on SEQRES records: (download)

>d4q2qa_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smklvkfrkgdsvglrlaggndvgifvagvledspaakegleegdqilrvnnvdftniir
eeavlflldlpkgeevtilaqkkkaaggglwfsdwl

Sequence, based on observed residues (ATOM records): (download)

>d4q2qa_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smklvkfrkgdsvglrlaggndvgifvagvledspaakegleegdqilrvnnvdftniir
eeavlflldlpkgeevtilaqkglwfsdwl

SCOPe Domain Coordinates for d4q2qa_:

Click to download the PDB-style file with coordinates for d4q2qa_.
(The format of our PDB-style files is described here.)

Timeline for d4q2qa_: