SCOPe 2.06: Domain d4q01a_: 4q01 A:

Lineage for d4q01a_ (4q01 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)

8. Domain d4q01a_: 4q01 A: [259464]
   automated match to d4epva_
   complexed with 2xh, gdp, mg

Details for d4q01a_

PDB Entry: 4q01, 1.29 Å

PDB Description: Second-site screening of K-Ras in the presence of covalently attached first-site ligands

PDB Compounds: (A:) K-Ras

SCOPe Domain Sequences for d4q01a_:

Sequence; same for both SEQRES and ATOM records:

>d4q01a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedcyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkh

Timeline for d4q01a_:

• d4q01a_ first appeared in SCOPe 2.04
  
• d4q01a_ appears in SCOPe 2.05
  
• d4q01a_ appears in SCOPe 2.07
  
• d4q01a_ appears in the current release, SCOPe 2.08