Lineage for d4q01a_ (4q01 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 2868108Domain d4q01a_: 4q01 A: [259464]
    automated match to d4epva_
    complexed with 2xh, gdp, mg

Details for d4q01a_

PDB Entry: 4q01 (more details), 1.29 Å

PDB Description: Second-site screening of K-Ras in the presence of covalently attached first-site ligands
PDB Compounds: (A:) K-Ras

SCOPe Domain Sequences for d4q01a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q01a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgavgvgksaltiqliqnhfvdeydptiedcyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkh

SCOPe Domain Coordinates for d4q01a_:

Click to download the PDB-style file with coordinates for d4q01a_.
(The format of our PDB-style files is described here.)

Timeline for d4q01a_: