SCOPe 2.04: Domain d4ppta_: 4ppt A:

Lineage for d4ppta_ (4ppt A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [259457] (1 PDB entry)

8. Domain d4ppta_: 4ppt A: [259458]
   automated match to d2p42b_
   complexed with ni, so4

Details for d4ppta_

PDB Entry: 4ppt, 1.5 Å

PDB Description: Engineered Dual Specific VHH Antibody in Complex with a Nickel (II) Ion

PDB Compounds: (A:) Engineered single domain VHH antibody

SCOPe Domain Sequences for d4ppta_:

Sequence; same for both SEQRES and ATOM records:

>d4ppta_ b.1.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
qvqlvesggglvqaggslrlscaasgyphpylhmgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtyghwgqgtqvtvs
s

Timeline for d4ppta_:

• d4ppta_ is new in SCOPe 2.04-stable
  
• d4ppta_ appears in SCOPe 2.05
  
• d4ppta_ appears in the current release, SCOPe 2.08