Lineage for d4ppta_ (4ppt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743704Domain d4ppta_: 4ppt A: [259458]
    automated match to d2p42b_
    complexed with ni, so4

Details for d4ppta_

PDB Entry: 4ppt (more details), 1.5 Å

PDB Description: Engineered Dual Specific VHH Antibody in Complex with a Nickel (II) Ion
PDB Compounds: (A:) Engineered single domain VHH antibody

SCOPe Domain Sequences for d4ppta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ppta_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasgyphpylhmgwfrqapgkeregvaamdsggggtly
adsvkgrftisrdkgkntvylqmdslkpedtatyycaaggyelrdrtyghwgqgtqvtvs
s

SCOPe Domain Coordinates for d4ppta_:

Click to download the PDB-style file with coordinates for d4ppta_.
(The format of our PDB-style files is described here.)

Timeline for d4ppta_: