Lineage for d4pjfa2 (4pjf A:179-269)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1030 PDB entries)
  8. 2356281Domain d4pjfa2: 4pjf A:179-269 [259451]
    Other proteins in same PDB: d4pjfa1, d4pjfb1, d4pjfb2, d4pjfc1, d4pjfd_, d4pjfe2, d4pjff2, d4pjfg2, d4pjfh2
    automated match to d4l4ta2
    complexed with 30w, gol

Details for d4pjfa2

PDB Entry: 4pjf (more details), 2.45 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-c10 tcr
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjfa2:

Sequence, based on SEQRES records: (download)

>d4pjfa2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv

Sequence, based on observed residues (ATOM records): (download)

>d4pjfa2 b.1.1.0 (A:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasiellyschvehsgvhmvlqv

SCOPe Domain Coordinates for d4pjfa2:

Click to download the PDB-style file with coordinates for d4pjfa2.
(The format of our PDB-style files is described here.)

Timeline for d4pjfa2: