Lineage for d4pjza_ (4pjz A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2153717Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)
  6. 2154375Protein automated matches [193860] (2 species)
    not a true protein
  7. 2154376Species Enterobacteria phage [TaxId:10665] [193861] (22 PDB entries)
  8. 2154385Domain d4pjza_: 4pjz A: [259448]
    automated match to d212la_
    complexed with gcs, gol, man, nag, po4, t55

Details for d4pjza_

PDB Entry: 4pjz (more details), 1.87 Å

PDB Description: crystal structure of t4 lysozyme-gss-peptide in complex with teicoplanin-a2-2
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d4pjza_:

Sequence, based on SEQRES records: (download)

>d4pjza_ d.2.1.3 (A:) automated matches {Enterobacteria phage [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknlgsscghpaaa

Sequence, based on observed residues (ATOM records): (download)

>d4pjza_ d.2.1.3 (A:) automated matches {Enterobacteria phage [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdaykpaaa

SCOPe Domain Coordinates for d4pjza_:

Click to download the PDB-style file with coordinates for d4pjza_.
(The format of our PDB-style files is described here.)

Timeline for d4pjza_: