SCOPe 2.06: Domain d4otxl2: 4otx L:111-212

Lineage for d4otxl2 (4otx L:111-212)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)

8. Domain d4otxl2: 4otx L:111-212 [259446]
   Other proteins in same PDB: d4otxl1, d4otxm1
   automated match to d3oz9l2
   complexed with azi, cl

Details for d4otxl2

PDB Entry: 4otx, 2.1 Å

PDB Description: structure of the anti-francisella tularensis o-antigen antibody n203 fab fragment

PDB Compounds: (L:) N203 light chain

SCOPe Domain Sequences for d4otxl2:

Sequence, based on SEQRES records:

>d4otxl2 b.1.1.2 (L:111-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceathktstspivksfnrn

Sequence, based on observed residues (ATOM records):

>d4otxl2 b.1.1.2 (L:111-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskd
stysmsstltltkdeyerhnsytceapivksfnrn

Timeline for d4otxl2:

• d4otxl2 first appeared in SCOPe 2.04
  
• d4otxl2 appears in SCOPe 2.05
  
• d4otxl2 appears in SCOPe 2.07
  
• d4otxl2 appears in the current release, SCOPe 2.08