SCOPe 2.04: Domain d4otxl1: 4otx L:1-110

Lineage for d4otxl1 (4otx L:1-110)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d4otxl1: 4otx L:1-110 [259445]
   Other proteins in same PDB: d4otxl2, d4otxm2
   automated match to d3eotl1
   complexed with azi, cl

Details for d4otxl1

PDB Entry: 4otx, 2.1 Å

PDB Description: structure of the anti-francisella tularensis o-antigen antibody n203 fab fragment

PDB Compounds: (L:) N203 light chain

SCOPe Domain Sequences for d4otxl1:

Sequence; same for both SEQRES and ATOM records:

>d4otxl1 b.1.1.0 (L:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qivmtqspssltvtagekvtmsckssqsllnsgnqknyltwyqqkpgqppklliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysypltfgagtklelkrad

Timeline for d4otxl1:

• d4otxl1 is new in SCOPe 2.04-stable
  
• d4otxl1 appears in SCOPe 2.05
  
• d4otxl1 appears in the current release, SCOPe 2.08