Class a: All alpha proteins [46456] (286 folds) |
Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
Superfamily a.126.1: Serum albumin-like [48552] (2 families) |
Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
Protein automated matches [254493] (5 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [256128] (4 PDB entries) |
Domain d4or0b3: 4or0 B:388-583 [259439] automated match to d4l8ua3 complexed with nps, peg, pge |
PDB Entry: 4or0 (more details), 2.58 Å
SCOPe Domain Sequences for d4or0b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4or0b3 a.126.1.0 (B:388-583) automated matches {Cow (Bos taurus) [TaxId: 9913]} kqncdqfeklgeygfqnalivrytrkvpqvstptlvevsrslgkvgtrcctkpesermpc tedylslilnrlcvlhektpvsekvtkccteslvnrrpcfsaltpdetyvpkafdeklft fhadictlpdtekqikkqtalvellkhkpkateeqlktvmenfvafvdkccaaddkeacf avegpklvvstqtala
Timeline for d4or0b3: