Lineage for d4or0b3 (4or0 B:388-583)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730697Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2730698Protein automated matches [254493] (6 species)
    not a true protein
  7. 2730699Species Cow (Bos taurus) [TaxId:9913] [256128] (5 PDB entries)
  8. 2730711Domain d4or0b3: 4or0 B:388-583 [259439]
    automated match to d4l8ua3
    complexed with nps, peg, pge

Details for d4or0b3

PDB Entry: 4or0 (more details), 2.58 Å

PDB Description: Crystal Structure of Bovine Serum Albumin in complex with naproxen
PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d4or0b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4or0b3 a.126.1.0 (B:388-583) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kqncdqfeklgeygfqnalivrytrkvpqvstptlvevsrslgkvgtrcctkpesermpc
tedylslilnrlcvlhektpvsekvtkccteslvnrrpcfsaltpdetyvpkafdeklft
fhadictlpdtekqikkqtalvellkhkpkateeqlktvmenfvafvdkccaaddkeacf
avegpklvvstqtala

SCOPe Domain Coordinates for d4or0b3:

Click to download the PDB-style file with coordinates for d4or0b3.
(The format of our PDB-style files is described here.)

Timeline for d4or0b3: