SCOPe 2.08: Domain d4or0b3: 4or0 B:388-583

Lineage for d4or0b3 (4or0 B:388-583)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [256128] (5 PDB entries)

8. Domain d4or0b3: 4or0 B:388-583 [259439]
   automated match to d4l8ua3
   complexed with nps, peg, pge

Details for d4or0b3

PDB Entry: 4or0, 2.58 Å

PDB Description: Crystal Structure of Bovine Serum Albumin in complex with naproxen

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d4or0b3:

Sequence; same for both SEQRES and ATOM records:

>d4or0b3 a.126.1.0 (B:388-583) automated matches {Cow (Bos taurus) [TaxId: 9913]}
kqncdqfeklgeygfqnalivrytrkvpqvstptlvevsrslgkvgtrcctkpesermpc
tedylslilnrlcvlhektpvsekvtkccteslvnrrpcfsaltpdetyvpkafdeklft
fhadictlpdtekqikkqtalvellkhkpkateeqlktvmenfvafvdkccaaddkeacf
avegpklvvstqtala

Timeline for d4or0b3:

• d4or0b3 first appeared in SCOPe 2.04
  
• d4or0b3 appears in SCOPe 2.07