![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.126: Serum albumin-like [48551] (1 superfamily) multihelical; one domain consists of two similar disulfide-linked subdomains |
![]() | Superfamily a.126.1: Serum albumin-like [48552] (2 families) ![]() |
![]() | Family a.126.1.0: automated matches [254216] (1 protein) not a true family |
![]() | Protein automated matches [254493] (6 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [256128] (5 PDB entries) |
![]() | Domain d4or0b1: 4or0 B:2-195 [259437] automated match to d3uiva1 complexed with nps, peg, pge |
PDB Entry: 4or0 (more details), 2.58 Å
SCOPe Domain Sequences for d4or0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4or0b1 a.126.1.0 (B:2-195) automated matches {Cow (Bos taurus) [TaxId: 9913]} thkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadeshag cekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpnt lcdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpki etmrekvltssarq
Timeline for d4or0b1: