Lineage for d4ogxl2 (4ogx L:106-212)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362078Domain d4ogxl2: 4ogx L:106-212 [259414]
    Other proteins in same PDB: d4ogxa_, d4ogxl1
    automated match to d1dn0a2
    complexed with so4

Details for d4ogxl2

PDB Entry: 4ogx (more details), 2.4 Å

PDB Description: Crystal structure of Fab DX-2930 in complex with human plasma kallikrein at 2.4 Angstrom resolution
PDB Compounds: (L:) dx-2930 light chain

SCOPe Domain Sequences for d4ogxl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ogxl2 b.1.1.2 (L:106-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d4ogxl2:

Click to download the PDB-style file with coordinates for d4ogxl2.
(The format of our PDB-style files is described here.)

Timeline for d4ogxl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ogxl1
View in 3D
Domains from other chains:
(mouse over for more information)
d4ogxa_