SCOPe 2.04: Domain d4ogxl2: 4ogx L:106-212

Lineage for d4ogxl2 (4ogx L:106-212)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d4ogxl2: 4ogx L:106-212 [259414]
   Other proteins in same PDB: d4ogxl1
   automated match to d1dn0a2
   complexed with so4

Details for d4ogxl2

PDB Entry: 4ogx, 2.4 Å

PDB Description: Crystal structure of Fab DX-2930 in complex with human plasma kallikrein at 2.4 Angstrom resolution

PDB Compounds: (L:) dx-2930 light chain

SCOPe Domain Sequences for d4ogxl2:

Sequence; same for both SEQRES and ATOM records:

>d4ogxl2 b.1.1.2 (L:106-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4ogxl2:

• d4ogxl2 is new in SCOPe 2.04-stable
  
• d4ogxl2 appears in SCOPe 2.05
  
• d4ogxl2 appears in the current release, SCOPe 2.08