SCOPe 2.04: Domain d4ogxl1: 4ogx L:1-105

Lineage for d4ogxl1 (4ogx L:1-105)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4ogxl1: 4ogx L:1-105 [259413]
   Other proteins in same PDB: d4ogxl2
   automated match to d1dn0a1
   complexed with so4

Details for d4ogxl1

PDB Entry: 4ogx, 2.4 Å

PDB Description: Crystal structure of Fab DX-2930 in complex with human plasma kallikrein at 2.4 Angstrom resolution

PDB Compounds: (L:) dx-2930 light chain

SCOPe Domain Sequences for d4ogxl1:

Sequence; same for both SEQRES and ATOM records:

>d4ogxl1 b.1.1.0 (L:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspstlsasvgdrvtitcrasqsisswlawyqqkpgkapklliykastlesgvps
rfsgsgsgteftltisslqpddfatyycqqyntywtfgqgtkvei

Timeline for d4ogxl1:

• d4ogxl1 is new in SCOPe 2.04-stable
  
• d4ogxl1 appears in SCOPe 2.05
  
• d4ogxl1 appears in the current release, SCOPe 2.08