Lineage for d3btke_ (3btk E:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60859Protein Trypsin(ogen) [50515] (6 species)
  7. 60860Species Cow (Bos taurus) [TaxId:9913] [50516] (128 PDB entries)
  8. 60950Domain d3btke_: 3btk E: [25941]
    Other proteins in same PDB: d3btki_

Details for d3btke_

PDB Entry: 3btk (more details), 1.85 Å

PDB Description: the crystal structures of the complexes between bovine beta-trypsin and ten p1 variants of bpti

SCOP Domain Sequences for d3btke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3btke_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d3btke_:

Click to download the PDB-style file with coordinates for d3btke_.
(The format of our PDB-style files is described here.)

Timeline for d3btke_: