Lineage for d4nl3b_ (4nl3 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057725Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2057726Protein automated matches [190914] (13 species)
    not a true protein
  7. 2057840Species Listeria monocytogenes [TaxId:1639] [259405] (3 PDB entries)
  8. 2057854Domain d4nl3b_: 4nl3 B: [259407]
    automated match to d4j6wf_
    protein/RNA complex

Details for d4nl3b_

PDB Entry: 4nl3 (more details), 3.1 Å

PDB Description: crystal structure of listeria monocytogenes hfq in complex with u6 rna
PDB Compounds: (B:) Protein hfq

SCOPe Domain Sequences for d4nl3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nl3b_ b.38.1.0 (B:) automated matches {Listeria monocytogenes [TaxId: 1639]}
kqggqglqdyylnqlrkekilatvfltngfqlrgrvvsfdnftvlldvegkqqlvfkhai
stfspqknval

SCOPe Domain Coordinates for d4nl3b_:

Click to download the PDB-style file with coordinates for d4nl3b_.
(The format of our PDB-style files is described here.)

Timeline for d4nl3b_: